SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3514 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3514
Domain Number 1 Region: 260-472
Classification Level Classification E-value
Superfamily Caspase-like 1.14e-36
Family Caspase catalytic domain 0.0049
Further Details:      
 
Domain Number 2 Region: 8-89
Classification Level Classification E-value
Superfamily DEATH domain 0.00000105
Family DEATH domain, DD 0.014
Further Details:      
 
Domain Number 3 Region: 131-184
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000027
Family C2 set domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm3514
Sequence length 639
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold10:669240:674808:1 gene:WBGene00223775 transcript:Bm3514 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3514
Sequence
MSSVASLQEYDLSTNLAELPIGLHWRLASSLNFQTVWMKVIGDSTSSPFSLSVSEYDRIL
RSENQGSSLLYLWGNRGQNVRHLLLRLQSFSKMHGTSLDGPQLALRRKFVPVKWSADEQI
TVKVIGADNCMLQLFCHARGFPWPHFQWMENDKDIDCSNGKALIISRCKCRKGLMYRCRI
WNEIEEGFEYSTFYRRPGKSFHSKLITKPVDLSLFITANVTVDSCKRCSAYKNLNLSTDF
FRTVQNEGNIGGWNAELIATDKVALIIGNCNYINLPSLVTPHCDAEMFAESLQNLGFKTV
ALGDLNLAEMHFFIKEYRKLLGDGVYAVFYFVGHGFEKNGKNYLLAVDAPSVDCKMTECI
SVEWVLSVFEDSHPALNLILLDVCRKNVKCVGCLDDADNEQIPKIARNTVCGYATSSGVS
AFEVHGERNGVFMKHLLQHIADEATVLEMLTKTFQEISNDTRICDVQIPELKSNLVLPRG
LRDPLICYGHTASFNCHTLYWRYMHELPSPINVQFTDQNMFVIIWYDYVGHFTNKVYIFT
SVNDLSDKNSAGGLKPLPTKFSHVAHLHFPKHVDVSAERIIEDGNDGVSISVMLSNLQRL
KGTVLFSVDLASRKDDVVIASKSNLSLGDVLVTRIYRVE
Download sequence
Identical sequences A0A0I9N9B8
Bm3514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]