SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3641d from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3641d
Domain Number 1 Region: 1937-2049
Classification Level Classification E-value
Superfamily Bromodomain 7.06e-35
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 2 Region: 1876-1929
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000115
Family PHD domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1816-1872
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000175
Family PHD domain 0.0021
Further Details:      
 
Domain Number 4 Region: 215-265
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000168
Family PHD domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm3641d
Sequence length 2070
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold57:179092:195552:-1 gene:WBGene00223902 transcript:Bm3641d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3641
Sequence
MDFEDEAEDEEIEETSSVASRVPTPGASLYETDESVECPWLEIPAEQLPILKLPKGSKDL
LIDEKYLFDALEVYETCRWYYQAIRLSPFLFEDFCAALSTEGQTNLLAEIHIALLKLSLK
DDDDEQIILSVQDTNNSFNIMLQLLEPMTYAEVLRQYLESDPQRFPAEVLEAASGNYPFV
GVKQRLTVLSWLCDRFFQTNEYRNIVRNEGKLTVDEHCRECGKPGDVLLCDGCEACYHLS
CTNLADVPDGKWLCQVCELHKVRGVTDCQVPGYRSPRMPMRFKPLGRDRHGRLYWFMVRR
IFVQNDIDGSVHYYSTLPQLYFLLNMLSVNEYEKHLAAVFMDLLPLIEEHMRMTLQLTGD
YGRSARARNKTDLYLHADNVVRMGDILAKPLFSQLRESDDERIVVAIGYTKHVEVSKYLL
LCKVEELLGFTGNCLKDTFWTAGMQTHEVITKKEVIETSFHTALVNGDIDEVPSVELGFR
LGEGDTLSRYVNQYSMNEYAKNPIQRAKERDKKKYMSGRFSLMDEGEFEWTVAKGRTLTG
KPIQIGKIIQNSMESFAQKIPSVLMHRLWKRDGLDYFKKGLSAPPTVELLKDLLLRFECA
IRRPVLHNVWWSTLGHTRLIRITVEDRERRQRYETKKKKQERELWAAEPDDDEVIWVKHH
KVGSILKRTLWRQNDEGYRVNGRGTLGGWLWKSNTFHRTFIPRAEKPNIGKILEPTSLAN
RKAIHLEKIVKCLNEWRIAELEGEERKWQKELLKKCYSPTCRMGIMPLPITSENDSVQGC
YSLTCRQAVSQSMGRTTSSVVHARPPSSSPSKSHQENGKDVKTLEMNKPFPLPLPFDYRV
RRTGEQSLLILPQKALKRLARQGGINLNYFAPGFHRLAKSNNQVWNYPCQRPLFDNCWRY
LVLRAQSYHSIALHLRVLYACIRWADMHREPDEDFRVTVHLADHDEVRTVIGHKEYPPDG
MYEQYKLSVELIPLDDNVELDDANEGLGSAAYHPSKSLEKTLRKRKATRGRSENGALRKD
HVKVVERWIDGIELKPWEIANYWKNIENRARRGLNAPSVITVGNRIPAPVIKHYESQTVH
SNRISGERRRPQPKRMPDYDYDIKDDEDEDDDDEYIDVETLPSIVEKSNSSLEPRPKVSR
LSEQRSERHLAGSPYKAQWQNPNILRQYEQVARRPGELLGGGKYTMFQKPDGTFCRVMVY
QNHPTQSTRTASAPGSVRTPPMIASQPRTGTYQRESVRIPVTRRVVSVPGSSHGSPVAPV
GKRLLLIRRSDGTTQYLRPVTTGTGTPGAYRTVRTTQAGGATINDVRGSATNSPFVRPLG
TTRTVFTGNQSVGRVLRLPARTVSVVNQPSSTENQASSTVRIGRMQPKRRVDGDEMLNDH
STDPSTAQVDEEYRLLTEKGLRSSGKPLGTAPVSGSTRPAVTVQPRQGLTAVVHSALDQQ
TSSGHIFGDHDPMVGSGSSAIGGDRYANMVRTETRTAGVTVRAHHGAEVVRVGLHGRGVS
SLYGKTQNELTDMTSSVGHSYASCRTHIKYIGTIDIRSNLYIRPFEQVDQRVIKEVLDNL
ITEVCIMDAENGWHRRHIQRIFEKRQEERKRREMQQRALKIERLSARQLEAELGERIEWF
KREVNKRRLKLEERAETEAGMIAPWRRPRRARELFPDSSAQLQAIAGMPVEPSTISLGGI
IHSDETASNKVDEQSTIQLPSENSNVQCAKTTGLIPDLSIQQQSGELSVKDQPLMDSGQQ
VEDTSQQRRSERSKKKKSWDESFIKIESLSTSQIPDSSETKTNGKTRKEQLRMTRGTTPS
TSSRPGTACSESIPDIDTTKRHCKCNQPYDPKKFYVGCDLCYQWFHGKCVGISERKSKKM
TSWLCADCAKEQKSSEKELYCVCQTPYDDSQFYVGCDGCEGWFHPRCVDITQEDAEKAAE
YLCPQCTQNKQANESSTSSSPPILLDRPDFDLLWHAFDSLKSHRTSWPFRQAVDQKNHPD
YYSIIKKPMDLSIVQRKLEHYEYHSLKEFTTDIAQIFENARIFNSKDSAIYQCADILEKQ
FRERIVKVKSAIETRASGKKGEKTAKKTKK
Download sequence
Identical sequences A0A0J9XQ82
Bm3641d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]