SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3950 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3950
Domain Number 1 Region: 7-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Domain Number 2 Region: 156-203
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000101
Family Motor proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3950
Sequence length 222
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold25:9378:12034:1 gene:WBGene00224211 transcript:Bm3950 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3950
Sequence
MAESSNENYKVPIGLRPLLEAFVRETLRTQPIDLVSFSILSFNVLQKHRKQNNAEDVFKD
SALYESFKIDLQKQYHEKDEMTERSLEPLEEAATKIQAAYRGHIVRANPQKFILSEKKTD
VTCSSTGRINLLDAEKNLKYHSVNVAGSVVHSNVIEDRAATIIQAEIRGFLTRRHFKQEK
KEGNDAAKKIQAHIRGYLTRKHLDEVGIPHKHSAVSHLHNGL
Download sequence
Identical sequences A0A0K0JCJ1
Bm1_37130 XP_001898873.1.25112 Bm3950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]