SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm4999b from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm4999b
Domain Number 1 Region: 224-388
Classification Level Classification E-value
Superfamily MIR domain 1.07e-23
Family MIR domain 0.0049
Further Details:      
 
Domain Number 2 Region: 1063-1200
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-22
Family SPRY domain 0.015
Further Details:      
 
Domain Number 3 Region: 658-787
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000021
Family SPRY domain 0.074
Further Details:      
 
Domain Number 4 Region: 4133-4210
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000047
Family Calmodulin-like 0.054
Further Details:      
 
Domain Number 5 Region: 108-191
Classification Level Classification E-value
Superfamily MIR domain 0.00000000392
Family MIR domain 0.02
Further Details:      
 
Domain Number 6 Region: 2246-2334
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000301
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm4999b
Sequence length 5033
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold4:1906764:1950735:1 gene:WBGene00225260 transcript:Bm4999b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-unc-68
Sequence
MTDKEGTGDGEQDDISFLRTGDIVAMTCMASASREGVLGSERVCLCTEGFGNRMCSLENV
SDRDLPADISMCMLYIDNALSVRALQEMMSNDKELRGAGSGGGHKTLLYGHAVQLKHVQS
EMYLACLSSCSSNDKLAFDVGVQENNEGEACWWTIHPASKQRSEGEKVRVGDDVILVSVA
TERYLHMTHSKGFMVIASFHQTLWNITSVSSGSVRIRNMGALFGNDVLRFFHGNDEVLTI
PENWSEHPQQNMAIYEGGAAVSQARSLWRIELIRIKWHGALVGWEQPYLGVMENVIQLYD
KDKAEFDTTAFVMYQTKDLKKQLLEEKEEGMGVATIRYGETNAFIQHIKTELWLSYQTSE
TTKKGLGKVEEKKAVALKDGHMDDCFTFFMALEEESKSARVIRKCSSVLNRFLRGIEALQ
REGKQAQDWNRVDLSEVLKLMEDLIDYFAQPDEDDFEASQNRLRALRSRQDLFQEEGVLN
MILDTIDKFSQMEAVRDFAGLLNEDTQMMWEEISTYLYLLVAAMIKGNHYNCAQFASAQR
LQWLFGRLSNPQSAEGILDVLYCVLTESPEALNMINESHIKSVISLLEKVGRDPKVLDVL
SSLCEGNGMAVRSSQNTITQYLLPGKDLLLQTKMRDHVSSMTPNILVGVVEGSSQFRRWY
YEAEVEHIERMTKTEPYLRIGWANSMGYKPFPGSGDGWGCIGVGDDYYSYGFDGRCIYCA
TKKHVIWTRTLQKGDVVGCLLDLNIPEISFTVNGQSTAGMFKNFNIDGFFFPVMSLSAKV
SCRFMFGGIEGRLRFGPPPGFSALIEAAANKLEIGECVSFGDIAKNVYTGPSILRQNTEP
FVPKLVDISAVVLPHFAMEIHEKMAENLHELWAMRKIELGWSYGEVRDEKTRRHPCLTSF
QQLPPNEKAYNINLAIDTMKTIEALRYHMILDEPPVRLRPVRLPQNYQQSNGFKPQPLDC
HEIVLDDNMFSLIDALAKNTHNVWAREKIRRGWTFGLNEFVNISQKRSPHLVPYEVVDQR
IKEANRESATEFIKTLQLFGIFLESPVLEHDEGAEKELKVTKAFSRTYRAEALYAVSSGK
WYFEFEVLTSGFMKVGWMDISAQSTVDIGTDDRSYGFDGYLARKWHQGAGTYGREWKIGD
IVGAFLDLSDHTISFSLNGELLLDPSGSEMAFDNVLVTDGFVPAMTFSAGQRAKLNFGQD
SNSLKYFTTCGLQEGYEPFCVNMYRQMPMWYAKRLPQFEDIGLNSTIEVSRIPATGNNPP
CLKITQKEIDTGDMTAQEKAKMEYIRLSLPVKCNEKLQPTKDKESIMRSLHEIEKQLAEE
AQPVPTIRHPAIPKEFGDDTKKSLGRSLLSAFKHSAEEDESSARSKPISFDGDHHLAETS
TIRMSGSMLELSSTGEQRDGKHKRGGLMARFHQRKKEGMSSENKRTTGMLVDGHIVSVDT
ISAENIPPSMSKDDQDMPQSGPGRSRRGLMGSDKWKKKNEKFLEHRRPSIAALEQSVIID
GNVPSDDVRTMIELGDKIDEFYYAIRIFPGQDPANVWVGWVTPKYHFYAERFITGEAIRR
CKYQGTSENVNEGESLEYRNCYVVNAAELLQSVPEPGNTKVSGLLIGCIIDTSVGELSFL
ASKQDTGFRFKLEPGAILYPAAFVAPTSAEVLQFELGRIKYTFPLSSAMFKSSHKSLLPF
CPPRLTVEKLNPVHWARVPNECLRTTALKLSDFRGWSVLCDDPVRIMSIYIPEKDTSYDI
LEMIEHNDLLTFHRQTLNLYCKLAAHGNQKVAHILCSHVDEDQILYAVKSHYLSGPLRQG
FHDFLIAVHLRTYVNARQSTTHEYVIPLKQNHEIKNVFHPEIEDRFPQILGPTISIRPVI
VCSEVRSNFGMDAESKLLPPAFNFVALKAHVMSALSSATEHAVISCRDLIGGNCLNHFEP
LFKLFNALLVIGIFDDDDLKDVMKLIHPIAFDENYVPGLKQKGLTEIELAEGVKIQLTII
LENICNIQLRHRVESLVSFAAGFVNDLQQDQFSRYMSIKQTNMTPAEAARRTKEFRCPPR
EQMFRLMKCKAVPDDSIGIMLDDETEYDQCPMNETLQQQLRQFCSLLVGRVGCVKSEERN
KLSELVILEEANSWVDQLAQLVIRVPPPFTGEDKSMNHNGTESFRLMICTMLKSWATSSV
IESNELIRKMFSLLLRQYTGVAEMMKALSQTYVLHERNIEDVQDFIENLVQVRELLSVQF
ESAEEAILKRGLWKLMNNRIFFQHPDLMRLLTVHENVMSIMMNVLTAQQGATNHGEHTEH
VENMEEIVNAQDSKDASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPS
LRGSVPLDIAYSSFMDNNELALALKEEELDKVTVYLSRCGLQPNLELVAKGYPDIGWDPV
EGERYIDFLRFCVWINGESVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAIALS
EDIRTLEENKNRAVIHSALLREQPHYPNKETEGEDYVDLGAATLDFYSSLVDLLAKCAPD
KINIQAGKGDCMRARAILRSLISLDDLGQILALRFTIPNLITSVATDDVGPLPGLLPNHK
QSVLLFLDRVYGIDSQEMLFHFLEKSFLPDLRAATMMDSPCSVESDTALALNRYLCNAVL
PLLTSHSYYFADAEHHAALLDTTLHTVYSMNHLRSLTKNQRDAVSDFLVAITRELPPPMM
VKLMRKVIIDIQEMDENLLVPLRILTLHYERCTKYYGSGNIYGMASETEKRLSMLLFYAI
FDSLGSKQYDPELFGKALPCLTAIGSAISPDYTLTTTGDDTDRIQKTKDRGIWNPDPVDV
SEVHFDDDLKSVVAKFAEHFHDSWASRKIEKGWNYGELYSRQALTHPRLKPFVFLPDFEK
NFYQERCAECLRALLVWNYSIELTDRDAADKAIQNNTSLGSSIENFNPKPVDLSNMTLEK
DMTGIAEKMAEESHKIWAKKVLADLNRGGTMPPQLVPWDLLTDFERRKDRFRAAEILKFL
QYHGYRVWSSNKPEPSAERVKIDSERSSVEKRFAYNLLKKLIQYLEQASLKMKTIKPSQE
LTRQNSFRKEGQDVKFFEKVVLPLMHAYFNAHKNYFLANSSVVQTGMASDKEKEMVANLF
CRLASLLRFKNHAFGNVAKITVRCLQGLIQSLDLRTLVKINSDIVRTGLLTFFNNCADDL
FSAVEELQNGGQYSLLRGQNLKSWVSLEFANQMIIPVLTTMFVHLAINHFGSDLLLDEIQ
AACYKILDSAYLLNSLAATTSQRKSIAYEMDKHRPALGQCLAAFAGCFPVAFLEDKFNKN
NKYSLLAKSQDQSVQVQEMLQNLLAHIPQLDKLLTEVEQVGQSGAMYREQPAAYDVDLPL
ICSYLTYWWQLGPDSSNRSTVPVTDVGNEHINRIFRALLQMIHNHIGVENASWLCRINFF
SVQIIPYVSCDAVKDYMLPVAERLRRLAEKAYREEEHMRTHPDDADEGTVAEDNAHLVRD
VYAYFPILMKYTDLHRAQWLKSPSWETDGVYENVAIIFKIWSLSQHFKREELNFMAQYED
ESVAGGTGEMKTGKAAIAERKKKRREGQMRKDKHAGSIVIACLKRLLPVGLNVFGGRELD
IVQQAKEKFLAKEPEDKIRELVRSLLDIPAKTDPTDKNAWQLNLYRKIGKSQMRNKDVMT
LDGIVDKITSMGQVVAILHVATSKFKKESRWERVLTLQRKRMAISLITASHLYRVEIHRA
INFFLPAFNKLWLEDEDVGQDALIKELTLEDEKQEQAYSKSGDEDVLSDEKDEKPQALPD
PLKQLIQCFQRAATSEQSQTISIANDSLFVNFAQVMSKSIHIEDEDEGDDEGELDQAQKE
EISQALRAEQAVLADRGAAIMCLMYLSASNGEPSDMVAEALQLGIHLLNGGNSKIQEMLI
DYLQLKKDVRFFTSLAGLMNKCSVLNLEMYERQIKAEGLGMGAELAAAANQNLNDSEFTC
SLFRFLQLTCEGHNLEFQNYLRAQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKDV
IDESGKEYFLRAIHVCSQVFNTLTESIQGPCTGNQMTLANSRLWDAINGFFFLFAHMMEK
LYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESEQNVEMILKFS
DMFLKLKDLTTSQAFQDFDTNRDGWISPKEFQRAMESQKMYSVEEITYLMMCTDVNNDGK
VDYMEFTERFHNPARDIGFNVAVLLTNLKEHITNDPRLEKIIKQASSLLEYFDPYLGRIE
IMGSSKKVEKIYFEIQESWLEQWSKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDT
IFEMQHAAEISAGDIADSKIERAKKQRDYFLQQTSAGAQISATFKTGFTYGVNAANALKP
ANVKKIFNTANATLRSMTWAQLVFAIITLSTKVSVKVAMFIYLVICTLLRFGYYLMTPDR
DELEVEQPALTMLESAGMQHTSPVWPSLQQYRRSCNYDVFGVRLPPTDAQASTTLQAQSK
TEATIAPTSVQQSKTVLKPSVVAQQCPSLYETQSFSGTDVHYNQALSPTVSEYGINDYYE
PKIAEQIPPRSRGSLLNMLARNFKTIEKTTLYLAFFINVILLFHRIRISDNVTSVNDTDD
DMESVYISGVILPYTSYEVTGWMLAQLLYWISVLHAVASFALLVSFYQLKIPLITFKREK
EVARRLMFDGCWLTEDDDEERSLTNTVFWYIDRIVISSKSFPMKYWDKFVRRKTRQKFRD
QTDEETLVTVLGEDKSATDTSFDYRYACWLWLGVILTNGQFLYRVHYLLCSALGVFVSPF
FYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVLAFNFFRKFYVQEG
EGEEPPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYWRMLYDISFFFFVII
ILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRLPRGFEIHTSKEHNFA
NYLFFLQHLVNKDETEYTGQETYVREKYDNRDWEFFPVGECFMKQYEDQLLQS
Download sequence
Identical sequences A0A158Q013
Bm4999b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]