SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm5018d from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm5018d
Domain Number 1 Region: 25-306
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-76
Family Protein kinases, catalytic subunit 0.000000123
Further Details:      
 
Domain Number 2 Region: 418-704
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.79e-64
Family Ankyrin repeat 0.0000193
Further Details:      
 
Domain Number 3 Region: 1320-1407
Classification Level Classification E-value
Superfamily DEATH domain 2.5e-16
Family DEATH domain, DD 0.0051
Further Details:      
 
Domain Number 4 Region: 726-749,803-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000771
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm5018d
Sequence length 1452
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold20:196789:217263:-1 gene:WBGene00225279 transcript:Bm5018d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-dapk-1
Sequence
MRDAHHRQVSSSSSSSGFDASVLRFNEEPFEQRYEIAEELGNGQFAVVRRVINRSSGEQF
AAKFIKKRRYATSRRGVTRCNIEREIDVLRAVGGYEYTIKLFEVYETSSDVILVLELVSG
GELFDYVSAKECLGETEAAAFIEQILLAIKHLHDNHIVHLDIKPENVMLRRRGESKIKLI
DFGLSRRILPGTVVKDMIGTPEFVAPEVVNYEPLSSATDMWALGVVTYILLSGGSPFLGE
TRDETFVNISAVNYHFSERYFEHISPYAKDFISRLFVRDQRKRATVDECLGHPWIRGPDE
LANDVRQYSMISMAQIRSFKIRLRWRRVVDIVIACNKMTADARSAVRKALEAGRSVSSRF
DPEELIVSAMLVACEEGNLAGLDQLAVLHRINLNIANRLNIAEQKSVRLFLLGVLQMGET
AIHVAAGAGQFDVVHYLHMKGAALDAADGRGDTPLFWATRNGHANIVGYITNEESVNINA
VNKNKESVLHVATRYAQLESALLLLERGINSSLQDEHSETALHIASWHGYAALLEILCRF
NPPVHLKNQDGETALHCAVARGHVECVQSLLDAGAPVDAVDQVGQTALHLALRRSHIDIA
LLLITKGCKLDVQDENGDTALHIASRIGLLSAVQTLCHLGAVIDVVNQNSLTPLHIAAKE
GHIEIIRCLCLFGANVLRKNKDGLTAEIIALAQEHTQIGTLLAKMKLDQTRDAYVEQLCP
LEMPLRRIKLKVFGHAGVGKTRLICSLQSGSVIGSIIGAVQRRFSDNPSPSSSTTASNPS
QDEGVNSFDDSVESNNNMKSGRRRAVPHLQYTRGIDVQNVTLQGCGEFSVWEFGGYEPYH
MAYDHFVGNTDCVHVIVYRCTDPTEIQYKQVLYWMNFLKGRVTPSEPIGHCGIISRRSKV
VIVGSHATPALFPLRNSDGDYVSSDGEAMLKTVRLRFETHFDIHDQLILLNSTQNNCPGM
KSLKIYLSKAREFILSRLQKPLGLLDTTVQYISGVRKQHAFFPVITWPHFTTLVRNEVNS
LAGDNHCRQLIQQLQLIGEVVYLRDEVSELDYVVLSPEWLGTHVLGNLLSAEFLSHCRIN
GCYSIDDFAPIYPEIADPADLLRILDTLQLCAPTDSDGEAEFEFPAFNVLDPPKDIWQRD
RPTYVYGGVRVLPMRGMERSLQSTFPRIQVALRRSMHDFQDPMDADLMQWNSCSKMSSGQ
MEALVRLHGDAVEIQVRGPCEIATSCFYFLEDITNLVEQTAQEVAPGISLERHFLSPKHL
REHFSNPAVYAPETIMAMQQAESLTIRNNQEGDELFTDVVCFGSRDVAALLTLGIDVGVA
QLQLASRCELAALLDPSDAMGRDWSILAVKLNLTDQLPEVDSTGQSLSRTDQLLAEWALQ
CPETATVGRLCTVLEELGRQDARDALYRTVPLYLFAPMDEQPVVHLTEYGDSGVVSSTQS
TTDPRSASTLSR
Download sequence
Identical sequences A0A1I9G4C1
Bm5018d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]