SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm6667i from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm6667i
Domain Number 1 Region: 24-186
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.69e-23
Family Nuclease 0.053
Further Details:      
 
Domain Number 2 Region: 351-427
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000251
Family Polyphosphate kinase C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm6667i
Sequence length 729
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold15:173835:179860:-1 gene:WBGene00226928 transcript:Bm6667i gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-pgs-1 description:CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A0K0JP52]
Sequence
MEELNEANYDTLEWLPQNAPYVEVDPEKIKLIKTPTEFYEKLLCLIREAKERIIISTLYF
GNGSYEKALVDELEKALAINPSLKMNILVDCLRGTRGTTENNSVVLLKRLTPRASVYLFH
TPCLRGLKKMVLPEKVNEVIGLQHMKLLVFDNHIIFTGANLSDIYFTNRLDRYIVIENCP
QLANFIDSLVEAVGSCSFMLNTQGTTSLAKRCDIHPFKGSHEAYKSMMYDRVMSTLNAFS
KECDLGNRFSTGTRIYPLLQMGIVSINQEFKFLKKLLSIQNHQLSLTISSGYFNFTDTYI
DLISNQNCFEMDVIYASPQANGFYQASGLFGFIPLMYVHISHLFYKIMGSTIRMFEYNRP
GWTYHAKGLWIDSKQSSLSATIIGSSNFGHRSVHRDLEAQFLITTCSEKLKRGLQEERSR
ILDYTTKVDAATFLQRDHFVPFWIRLISRANAINVYVGRFIVDTFIYRHSSLNMVLLQGL
IFGRALMELLARKGPTPTATAIRLSHRNRAQRKNGMHCGFKHTVNPYERKELLQRLGSCS
VRHLSSGTAAASSPKSLNEFLKDEVWIPVYRFRGIHYSVMATKVKLALTISSVSLIPYKY
WQYLDDTVSIDHFISISAFASFTTLAFIFFCRFFNGLIGVISMNETNEYIRVGYLSFWGT
RCNKYMKVDDVIPLNELSTGINNKVIRLRQYSSNGMLRLSLFNAELLDKERATILFGDIN
VFSSAKKTE
Download sequence
Identical sequences A0A1I9G1F2
Bm6667i

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]