SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm7324 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm7324
Domain Number 1 Region: 32-102
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000565
Family Caspase recruitment domain, CARD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm7324
Sequence length 113
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold351:33512:34627:-1 gene:WBGene00227585 transcript:Bm7324 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm7324
Sequence
MSADSQTLPCSRPLADSRIEQSYHLDQLRSKLARLDMRDLVPQLVARQVLRSQEMSAVYS
EEKREDQVDKLIEILKTKNHWLGPLIDALIRNGQATLAKELLAINNTKTNKST
Download sequence
Identical sequences A0A0I9N5P6 A0A0R3R916
Bm7324 XP_001894927.1.25112 Bm1_17350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]