SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm8763 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm8763
Domain Number 1 Region: 31-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.61e-44
Family Ankyrin repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 232-458
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.1e-19
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 507-553
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000129
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm8763
Sequence length 561
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold202:26482:31753:1 gene:WBGene00229024 transcript:Bm8763 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm8763
Sequence
MKRARSDWTSSSIPEFEEESIVVESNVTVGVACRLGNVELTQQLLHAGYGAFPDDRSWWP
IHEAAYGLHLDCCKVLVESGRCNVNAQAHDSVTPLMLVCRMSSRHDEALEVARYLLDNGA
NPNSRTLDEMTPLIQAIKSKNTALALLLIDRGANPLDVWYDGWSALHESADTKDLVIMQR
LISLGADIFAVDVKRHTALMVAVQENFFPGVRLLLKVARDRAAELANISVENGLTCVMAA
ADAGFEDILLLLINHGADCNITLHPIWGDDGSRIHAIAAAALNNHPKCVELLIPHVNKEI
LKETEIDPVSAAAYSGSYECICLLLDAGFSTEVPMCSCEPVGMIIPYLRPLFSRRYHTPL
REAVRKGYTLVVERLLKAGAKMTYVKNCFSPFLFAFRNRIDPAILYKFLENDVDINAMSV
KRTCDVPDALVSALGTCNRRQLLLLLSCGLDPALKNWCKCNNGYSLMYDVMQTTYVTDVD
KLMKLLVLFSSGIPSCCNEVAEVIGAQPKIPKLLHLCRLAVRKCFRTSKLLHGRFLDDLP
IPKSLRDYMIFHPIPEELRPS
Download sequence
Identical sequences A0A0H5S3H1
Bm8763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]