SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm9505 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm9505
Domain Number 1 Region: 2283-2582
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-106
Family BEACH domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 2172-2273
Classification Level Classification E-value
Superfamily PH domain-like 4.49e-19
Family PreBEACH PH-like domain 0.0037
Further Details:      
 
Domain Number 3 Region: 2696-2921
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.33e-17
Family WD40-repeat 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm9505
Sequence length 2933
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold7:273301:297665:-1 gene:WBGene00229766 transcript:Bm9505 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm9505
Sequence
MVIETCEPELKDDLLQVYAYMAMRNKKRELEEKGCKRWQQLGLNAYVGWRTGLLAYLRDS
LERNEVVEPRTTLLLAIVARLPLNPRCGLEGHSKEIAAKLADYLGKFPSSSLFAEISFCD
AQLLSNLQCERCNEEENINENEKDDKFCKRKQRSVMVGWDNIFHLDQDEFTVEQESAAIL
KDSALKIMYYKMVDHSPDAISEFETFAHSLSIFARLIEDSSIYGFVVKQLLSHDFPITGK
NKQVIIAWEVMLSLLLRGSTNFLRSESDISGFPFRRVVIECIICCAAKIANNINAYMCSS
SMNFELRTDCYSLFDGIIKYYSYFSNYIVQYSNRIALLKKSLPKSKLDFKENGKRFPYFD
VQCAYKFVHDIVTEIVTNCSEEAVLSEILSCALSLPDEYYSFIGIKSVFTTFLSAHLLDN
FIDRCAEIIAKQQHNFDRRTVTAMPSAFLVSLQNRIGNFQGAKFICLLQTLSSICPFLLV
QDVEIICLAILNRFKNESSLSKKWNDSAKLNDISIHCDAMADFLAEYLFGQKAIEFAVSD
VILPCMALLETSAASFNLVYIICKRSIIVGSNLISSKSVEDLAKSISDRLSRELTYPSPD
IWTLIGITDFAIPLLHVADLLLLLLSYCTEKVLPSGFLICAKQYSSTLVCITMDWMLAPN
EVDSHMLRISQLFSVSLRIVFATNVAEFLGADKFYSQLSVVSILLLQKHIQVKRSVSSNN
EYYIRKICGTLQHAMLNAQFDKNVLFSKLNRLILHLLRTLAEISVSSNCFRVSLTFYFNF
ISTNLTPSDIRNVFAIVRNARYLQVALTEVLLGLLPNEKVEPKDVYVFPQKIHAHMRINC
DGTVLNNLQFDGSDWKGKSAPSWSASLCNEHTEDMHNAKLFSGSLSNLAVSKHEDDSFDG
CCAAKLALDCLEQVYPVCSVDTNNLSFLLQVSFDSRTLHRRCLPSVLTDDAWNHIVVSVV
VVDSMLSVHVWINSQRFIMRVKHKCAVSLEQLSFVFGFGALQKDLVYSETFYELSPILSF
RGSLKAPQVLILRALGCDCISLAACNISSLMLRLTSLLSSQNLFVQQNAVLKLFADVETA
FACLQQDFLFVIRDRMAYVQRKCYSHNTKKKLELDPLPSTERHLLEWNCPMVKRLGKTST
ADCWLSLGSQNLFLFMFAEAIDLKHSAYEQAITFHLLFQFLRRVSPFTSEYTFSNVYDCV
IRCLSSSLACLGAQMLEEFRSTCISLPPRMKCSSGRSKQWFIVDPELVVRLVCAPWIWRG
RERMLQWRIILEDIAHCISDETAECSAFSRGQLKRAILEMLQDDKNYRIEMQDVTPLTDT
LLTIIRIMLGSLAVAEGIIHLWNFIFLSHAAAYTYITYGHTDHFQWLQQELLQEECKFDL
LKDTDLVGRLKDYGNILGKNRVVEVWTKERSVIKLRQMYDAVCLVDNQNNEYSADSKCPT
TVCKKGVLDLACNLRRAKGESYESSENAVMKEEKKVDWFCDLRCRCLEQLALVVQNAPDA
SFTELVNMRISWQAVVVLLTNQSDERFRDHVFNLLKHILLRADSEMRSDFIKNDGFELLS
SQMRGYPITDEIASSLFSLLFEEPIRFSDELGSDHVPFLKLNQFKYLSLKAIFVLWEESL
FNENEMLMQAMINSGLCTTVVSVLRRIASLPPITTDLIHGSATAPFMECWFGIVRRIIRL
CLPYRNSHLYSMCQEMLWLLEMAVLNVDIQSERITRQGLTCVYSLWFTVLQEFYLSNGKS
NWDSMSDLLAAGEESADDVVDNEMQSDIAPTSNFLSETLSAVVGTIADFRDRKFFYRNSY
SKRLPPIGERAERLIFCVTEISHFFTSMPVKSLEAVTNQEMKLFKIFLSFLSLVCKQNDT
RIVTFEHLNNKQRLMNICGERIGHLFGPLIAFVLFPASTKASKLSFVTSNTGRNGNSWEM
KRRLMIVKMLVSNKNHLKSLLGANLEYQCALNLSLHELALLNTIEDLDVQKDIENLIRFL
RKLQIESPLATLDADRLMSLNMDESLAIHGYLEYSNKFLTRVQQRAIRFIVEEKQQTKIR
SEVAMQMTCRVVEDQNLLRKNFMKTCRESELKNMAANVFLDGLLTELCHPEGLFYDAESW
PSSWALDPTEGPNRERRRLMPSHLSFDIKFLRPQSINKIKKRKKSPPLFHLLSDLRGNIN
ELSLEDGLVPGERIILSLSAVVVRSTVESSGEILAGDKRFYFHSDYTRSVQKRLSRTNTL
FIRWSYGDLVEIYKRHHLLKDTALEIFLSDGQTYLIVFEDQAKRDQFGLQILSSDLCKLS
SFSNVSVQSATQLWREGAITNFEYLMQLNKLAGRSYNDLMQYPVFPFVLSDYKSTVLDLT
NPISFRDLSRPMAIQDKRLEKHYLRKYSYLAREEVQAVSGCGSPFMFGPYHYGSHYSNIG
IVAHYLVRLPPFTDIALEYQDNNFDIADRLFNSIETTWRLASFDSTTDFKELIPEFFYLP
DFLMNKENLNLGMRQNGDIVDDVILPKWCQGSARLFVLIHRQALESSFVSSALNYWIDLI
FGYKQTGKAAIDAINVFHPATYRMNTVHGLNDEYDELSISALRTMIQTYGQMPLQLFRSP
HLPPLCGKMHQNIPSISLNPLDTVRGIRWGEFIGSPDTEFGNLTVVLNQKLPSSDWSGRL
VAFSEGTCFAFPSNTCFIYKYGEGVRPRNLCSYGLVTWRHNDGILRLRLHEPKLWWDLAS
YHTYNVVTTAYCVSFDLLFIGLSCGIILTYRIQLSEFGVKDFALLKTLYAHDTAVRALAV
CGNFAVAASGCDMGKICIWDLNRLSYVRTLVPGNRREVQFICISRTSCDVAIVAYSGYGS
NVTLKTINGLEIGSIDTDIVVTAIAMTSISEGTAVNCVFLGMQNGVIRIFDMWTMKFVRD
IVDYRFLEPVVSISFSNRCTRLFVNFSSGRVLCWQGENLQPKRPPSLSIISDM
Download sequence
Identical sequences A0A0K0JZI7
Bm9505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]