SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000006 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000006
Domain Number 1 Region: 18-81
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000785
Family SNARE fusion complex 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000006   Gene: ENSMMUG00000000007   Transcript: ENSMMUT00000000007
Sequence length 127
Comment pep:known chromosome:MMUL_1:3:123237385:123247050:1 gene:ENSMMUG00000000007 transcript:ENSMMUT00000000007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAGLGEGVPPGSYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQ
NKLLSEMDSQFDSTTGFLVNASGSRDFTNSNESLLLLILTVAQHLSRSFKKKSRLTFSAI
YHSCRII
Download sequence
Identical sequences G7P1D0
ENSMMUP00000035065 ENSMMUP00000000006 9544.ENSMMUP00000035065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]