SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000134 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000134
Domain Number 1 Region: 287-462
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.31e-56
Family SPRY domain 0.0000176
Further Details:      
 
Domain Number 2 Region: 10-79
Classification Level Classification E-value
Superfamily RING/U-box 6.19e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 92-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000058
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000134
Domain Number - Region: 139-230
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0157
Family Apolipoprotein 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000134   Gene: ENSMMUG00000000099   Transcript: ENSMMUT00000000145
Sequence length 469
Comment pep:known scaffold:MMUL_1:1099214741311:9301:10778:1 gene:ENSMMUG00000000099 transcript:ENSMMUT00000000145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAALTGFQAEAKCSICLDYLRDPVTIECGHNFCRSCIQQSWLDLQELFPCPVCRHQC
QEGHFRSNTQLGRMIEIAKLLQSTKGNKRRQEETTLCEKHNQPLSVFCQEDLVVLCPLCT
QPPDHQGHHVRPIEKAAIHYRKRFCSYVQPLKKQLADLQKLINTQSKKPLELREMVENQR
QELSSEFEHLNQFLDCEQQAVLSRLAEEEKDNQQKLSANITAFSNYNATLKSQLSKVVEL
SELSELELLSQIKIFYESENESSPSIFSIHLKRDGCSFPPQYSALQRIIKKFKVDIVLDP
ETAHPNLIVSEDKKCVRFTKRKQKVPSFPKRFTVKPVVLGFPYFHSGRHFWEIEVGDKSE
WAIGICKDSLPTKARRPSSAPQECWRIELQDDGYHAPGAFPTPLLSEVKARAIGIFLDYE
MGEISFYNMAEKSHICTFTDTFTGPLRPYFYVGPDSQPLRICTGEDAEA
Download sequence
Identical sequences ENSMMUP00000000134 ENSMMUP00000000134 9544.ENSMMUP00000000134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]