SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000170 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000170
Domain Number 1 Region: 287-488
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.89e-19
Family Crotonase-like 0.00000127
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000476
Family Chromo domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000170   Gene: ENSMMUG00000000128   Transcript: ENSMMUT00000000183
Sequence length 500
Comment pep:known chromosome:MMUL_1:X:7002702:7009282:1 gene:ENSMMUG00000000128 transcript:ENSMMUT00000000183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGYNSKDDTWEPEQHLMNCEEYIHDFNRHHTERQKESTLTRTNSSTPNNARKQISRSTNS
SFSKTPPKAPVTGRDHESKSSQLFAASQQFRKSRALSLCSQTKMDLVKSGTKILMSKSPI
KQDALDGFQSKSPKKLDSEDKGQEEVVPKVAVEKPDKALLGPGAEQARMGSKWIHLLVPQ
VHGPVTAAMATGLLANRKGTSTFMDALTASGTTDTQTSVTGVSVSKRKFIDNRREQPFNK
RLRFSVRQTESAYIYRVIVLGTQDGFTTSSYSLDNCNEKSLPALRTTTADHSKLVLFSTF
NSVFCCGLDFVNFVRCFTDDRKRERSEMVEAIRKNFVNTIIEMKKLLLKEAVNGPDNRLG
ASILPLCDIGWANEKAWFPTPSTTSRQIPDSSCSITFAKIMGRPAASERLLSGFQFIRQE
AFSNGLFSQVFRSWTFTQETGGQIKKLVSYKPVVLKECKSLLCYNMKNDLKQASERTCEV
LKKIWGSAQELDSTLYYLQT
Download sequence
Identical sequences ENSMMUP00000000170 ENSMMUP00000041255 9544.ENSMMUP00000041255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]