SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000231 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000231
Domain Number 1 Region: 31-295
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.27e-31
Family Haloperoxidase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000231   Gene: ENSMMUG00000000168   Transcript: ENSMMUT00000000244
Sequence length 316
Comment pep:known chromosome:MMUL_1:11:87018484:87150561:1 gene:ENSMMUG00000000168 transcript:ENSMMUT00000000244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLGSEDPSRMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHG
AGEHCGRYEELAQMLMGLDLLVFAHDHEGHGQGQGEGEGRIEAIFALFLITAFLHSRDLL
LDIYPGVELLGLFHSGGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVL
NLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKL
TVPFLLLQGSADRLCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEIN
MWVSQRTATAGTASPP
Download sequence
Identical sequences G7N7W4
ENSMMUP00000000231 ENSMMUP00000000231 9544.ENSMMUP00000000231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]