SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000265 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000265
Domain Number 1 Region: 370-554
Classification Level Classification E-value
Superfamily NTF2-like 2.46e-65
Family NTF2-like 0.000000012
Further Details:      
 
Domain Number 2 Region: 109-199
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.74e-36
Family Non-canonical RBD domain 0.0000047
Further Details:      
 
Domain Number 3 Region: 204-359
Classification Level Classification E-value
Superfamily L domain-like 4.08e-30
Family mRNA export factor tap 0.000000241
Further Details:      
 
Domain Number 4 Region: 551-619
Classification Level Classification E-value
Superfamily UBA-like 5.87e-26
Family TAP-C domain-like 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000265   Gene: ENSMMUG00000000188   Transcript: ENSMMUT00000000280
Sequence length 619
Comment pep:known chromosome:MMUL_1:14:11278803:11294093:1 gene:ENSMMUG00000000188 transcript:ENSMMUT00000000280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSSRLEEDDGDVA
MSDAQDGPRVRYNPYTTRPNRRGDTWHDRDRIHVTVRRDRAPPERGGAGTSQDGTSKNWF
KITIPYGRKYDKAWLLSMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAVNYKIL
DRENRRISIIINSSAPPHTILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVA
QNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG
NELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYIRSVKPGFPKTQRRDGHELPPPI
AFDVEAPTTLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSI
PFIPQNPARSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFV
VDISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNAS
SEEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSA
QAFTHLKAKGEIPEVAFMK
Download sequence
Identical sequences ENSMMUP00000000265 9544.ENSMMUP00000000265 ENSMMUP00000000265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]