SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000304 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000304
Domain Number 1 Region: 241-341
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.72e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000594
Further Details:      
 
Domain Number 2 Region: 93-145
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000432
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 3 Region: 14-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000055
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000304   Gene: ENSMMUG00000000215   Transcript: ENSMMUT00000000322
Sequence length 669
Comment pep:known chromosome:MMUL_1:19:52651897:52701471:1 gene:ENSMMUG00000000215 transcript:ENSMMUT00000000322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLT
ISYLRMHRLCTAGEWNQVGAGGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKHLGLS
QLELIGHSIFDFIHPCDQEELQDALTPQQNLSRRKVEAPTERCFSLRMKSTLTSRGRTLN
LKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGA
FLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAV
TGQYRFLARNGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHS
RRPIQRGAPSQKDTPNPGNSLDAPGSRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGP
ILDGASVAATPSTPLATRHPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQ
DADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPALEPSLL
PRWGSDPRLSCSNPSRGNPSASSSMAGARKRTLAQSAEDEDEGVELLGVRPPKRSPSPEP
ENFLLFPLSLSFLLTGGPAPGRLQDPSTHLLDLNEPLGLGPSLLSPYSDEDTTQPRDHFQ
PTAGSAQAD
Download sequence
Identical sequences ENSMMUP00000000305 9544.ENSMMUP00000000305 XP_001108464.2.72884 ENSMMUP00000000304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]