SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000328 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000328
Domain Number 1 Region: 414-770
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.92e-111
Family Hect, E3 ligase catalytic domain 0.0000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000328   Gene: ENSMMUG00000000238   Transcript: ENSMMUT00000000351
Sequence length 776
Comment pep:known chromosome:MMUL_1:9:90919951:91014067:1 gene:ENSMMUG00000000238 transcript:ENSMMUT00000000351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEAGRVPSPATPLVVAAAAPEERKGKEPEREKLPPIVSAGAGATAGLDRGAKGQISTFS
SFISAISPKKEAAENRSSPAHLVFPNIKNVRDQPPICLDVRQKQRVSMDASSSEMKAPVL
PEPILPIQPKTMKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFKKDATASFNTI
EDSGINAKFVNAVYDTLLNTPQDIQKTVLKGIINSLLREWKGPRTKDDLRAYFILLQNPQ
FNNTSTYVIYAHLLRQIATLVEADHHFLVHWFKKLSQKRFKQLVERLLQFISLRLFPAKP
EEFPPITKCSWWIPSAAKVLALLNTANNLVHLPLIPYTDFYNSTLDHIDLMEEYHTWQNF
GNSHRFSFCQYPFVISIAAKKIIIQRDSEQQMINIARQSLVDKVSRRQRPDMNMLFLNMK
VRRTHLVSDSLDELTRKRADLKKKLKVTFVGEAGLDMGGLTKEWFLLLIRQIFHPDYGMF
TYHKDSHCHWFSSFKCDNYSEFRLVGILMGLAVYNSITLDIRFPPCCYKKLLSPPIIPSD
QNIPVGICSVTVDDLCQIMPELAHGLSELLSHEGNVEEDFYSTFQVFQEEFGIIKSYNLK
PGGDKISVTNQNRKEYVQLYTDFLLNKSIYKQFAAFYYGFHSVCASNALMLLRPEEVEIL
VCGSPDLDMHALQRSTQYDGYAKTDLTIKYFWDVVLGFPLDLQKKLLHFTTGSDRVPVGG
MADLNFKISKNETSTNWLPVAHTCFNQLCLPPYKSKKDLKQKLIIGISNSEGFGLE
Download sequence
Identical sequences A0A096P5H1 A0A2K5UGR6 A0A2K6DXT0 F6XAR8
ENSMMUP00000000328 ENSPANP00000020596 9544.ENSMMUP00000000328 XP_001088322.1.72884 XP_005565996.1.63531 XP_011737607.1.29376 ENSMMUP00000000328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]