SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000435 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000435
Domain Number 1 Region: 34-189,216-340
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-57
Family FCH domain 0.0044
Further Details:      
 
Domain Number 2 Region: 504-627
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.00044
Further Details:      
 
Domain Number 3 Region: 661-743
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-18
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000435   Gene: ENSMMUG00000000323   Transcript: ENSMMUT00000000471
Sequence length 885
Comment pep:known chromosome:MMUL_1:X:152027704:152047432:-1 gene:ENSMMUG00000000323 transcript:ENSMMUT00000000471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLVERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVN
AEAKLREAERQEEKRAGRSVPTTTAAATEAGPLRKSSLRKGGRLVEKRQAKFMEHKLKCT
KARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYMAAESRTQASQVQ
GLGSLEEAVEALDPSGDKAKVLEVHATIFCPPLRFDYHPHDGDEVAEICVEMELQDEILP
RAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSD
PGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEREMSW
TQYTQRKFQKSRHPCPSSQYNQRLFGGDMEKFIQCSGQPVPLVVESCIRFINLNGLQHEG
IFRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFSE
LLASSELEATAERVEHVSRLLWRLPAPVLVLESLGADNEPEWKLRCLPRRMVRAMGREPH
PVPALVSTPAPPTHSLDPLSSPDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERASS
DWWRGEHNGVRGLIPHKYITLPEGAEKQVVGAGPQTAGESGSSPEGLLASELVHRPEPCI
SPEAVGLSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASATSPS
PGPRSPKAPAGSRLGKNKGFSRGPGAPASPSASHPQGLDTTPKPH
Download sequence
Identical sequences ENSMMUP00000000435 ENSMMUP00000000435 9544.ENSMMUP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]