SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000451 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000451
Domain Number 1 Region: 294-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.21e-43
Family SPRY domain 0.0000754
Further Details:      
 
Domain Number 2 Region: 5-91
Classification Level Classification E-value
Superfamily RING/U-box 8.01e-26
Family RING finger domain, C3HC4 0.0065
Further Details:      
 
Domain Number 3 Region: 88-152
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.29e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000451
Domain Number - Region: 141-214
Classification Level Classification E-value
Superfamily YehR-like 0.0641
Family YehR-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000451   Gene: ENSMMUG00000000335   Transcript: ENSMMUT00000000487
Sequence length 497
Comment pep:known chromosome:MMUL_1:14:67657110:67672585:1 gene:ENSMMUG00000000335 transcript:ENSMMUT00000000487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGILLNVKEEVTCPICLELLTEPLSLHCGHSFCQACITANHKKSMLYKEGERSCPVCR
ISYQPENIQPNRHVANIVEKLREVKLSPEEGQKVDHCARHGEKLLLFCQEDSKVICWLCE
RSQEHRGHHTFLMEEVAQEYHVKLQTALEMLRQKQQEAEKLEADIREEKASWKIQIDYDK
TNVSADFEQLREILDWEESNELQNLEKEEEDILKSLTKSETEMVQQTQYMRELISELEHR
LQGSMMDLLQGVDGIIKRIENMTLKKPKTFHKNQRRVFRAPDLKGMLDMFRELTDARRYW
VDVTLAPNNISHAVIAEDKRQVSSRNPQIMYQAPGTLFTFPSLTNFNYCTGVLGSQSITS
GKHYWEVDVSKKSAWILGVCAGFQSDAMYNIEQNENYQPKYGYWVIGLQEGVKYSVFQDG
SSHTPFAPFIVPLSVIICPDRVGVFVDYEACTVSFFNITNHGFLIYKFSQCSFSKPVFPY
LNPRKCTVPMTLCSPSS
Download sequence
Identical sequences Q0PF16
ENSMMUP00000000451 9544.ENSMMUP00000000454 ENSMMUP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]