SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000455 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000455
Domain Number 1 Region: 477-635
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-42
Family FAS1 domain 0.00059
Further Details:      
 
Domain Number 2 Region: 240-374
Classification Level Classification E-value
Superfamily FAS1 domain 5.89e-35
Family FAS1 domain 0.00063
Further Details:      
 
Domain Number 3 Region: 74-236
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-34
Family FAS1 domain 0.001
Further Details:      
 
Domain Number 4 Region: 378-501
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-23
Family FAS1 domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000455   Gene: ENSMMUG00000000332   Transcript: ENSMMUT00000000491
Sequence length 684
Comment pep:known chromosome:MMUL_1:6:132449426:132483495:1 gene:ENSMMUG00000000332 transcript:ENSMMUT00000000491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALFVQLLALALALALDPAATLAGPAKSPYQLVLQHSRLRGRQHGPNVCAVQKVIGTNKK
YFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQL
YTDRTEKLRPEMEGPGSFTIFAPSNEAWASLPAEVLDSLVSNVNIELLNALRYHMVGRRV
LTDELKHGMTLTSMYQNSDIQIHHYPNGIVTVNCARLLKADHHATNGVVHLIDKVISTVT
NNIQQIIEIEDTFETLRAAVAASGLNTMLEGNGQYTLLAPTNEAFEKIPSETLNRILGDP
EALRDLLNNHILKSAMCAEAIVAGLSLETLEGTTLEVGCSGDMLTVNGKAIISNKDILAT
NGVIHYIDELLIPDSAKTLFELAAESDVSTAIDLFRQAGLGTHLSGSERLTLLAPLNSVF
KDGTPPIDAHTRNLLRNHIIKDQLASKYLYHGQTLETLGGKKLRVFVYRNSLCIENSCIA
AHDKRGRYGTLFTMDRVLTPPMGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF
APTNEAFRALPPRERSRLLGDAKELANILKYHVGDEILVSGGIGALVRLKSLQGDKLEVS
LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSALEIFKQASAF
SRHGRRRPLGPAPVYQRLLERMKH
Download sequence
Identical sequences ENSMMUP00000000452 ENSMMUP00000000455 9544.ENSMMUP00000000452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]