SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000459 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000459
Domain Number 1 Region: 294-495
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-47
Family SPRY domain 0.0000403
Further Details:      
 
Domain Number 2 Region: 5-91
Classification Level Classification E-value
Superfamily RING/U-box 6.83e-26
Family RING finger domain, C3HC4 0.0058
Further Details:      
 
Domain Number 3 Region: 88-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.31e-17
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000459   Gene: ENSMMUG00000000338   Transcript: ENSMMUT00000000495
Sequence length 498
Comment pep:known chromosome:MMUL_1:14:67624629:67636923:-1 gene:ENSMMUG00000000338 transcript:ENSMMUT00000000495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFSVKVDIEKEVTCPICLELLTEPLSLDCGHSFCQACITAKIKESVTISRGESSCPVCQ
SRFQPGKLRPNRHLANIVERVKEVKMSPQEGQKRDICEHHGKKLQIFCKEDGKVICWVCE
LSQEHQGHQTFRINEVVKECQEKLQAALQKLTKEDQEAEKLEDDVRQERTKGKNYIQLER
QKILKGFNEMRVILDSEEQRELQKLEEGEVNVLDNLAAARDQLVQQRQDASKLISDLQRR
LRGSSIEMLQDVIDVMKRSENWTLKKPKPVSKKLKSVFRAPDLSRMLQVHKELTDVQCYW
VDVMLNPNSTISNVAVSVDQRQVATVRTFTFKNSNPRDFSDFGVLGCQYFSSGKYYWEVD
VSGKIAWILGVYSKISSPNKRKSSGFVFDPSVNYANVYSKYRPQYGYWVIGLQNTCEYNA
FEDSSSADPKVLTLFMAVPPCRVGVFLNYEAGIVSFFNVTNHGALIYKFSGCRFSQPAYP
YFNPWNCQVPMTLCQPSS
Download sequence
Identical sequences 9544.ENSMMUP00000000458 ENSMMUP00000000459 ENSMMUP00000000458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]