SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000486 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000486
Domain Number 1 Region: 18-161,190-253
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.94e-49
Family BAR domain 0.0086
Further Details:      
 
Domain Number 2 Region: 273-469
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000486   Gene: ENSMMUG00000003854   Transcript: ENSMMUT00000000529
Sequence length 699
Comment pep:known chromosome:MMUL_1:10:81571819:81580440:1 gene:ENSMMUG00000003854 transcript:ENSMMUT00000000529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLARILAEFEMTLE
RDVLQPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQATKNSGSSQGLGGGPGSHS
HTTMANKVETLKEEEEELKRKVEQCRDEYLADLYHFVTKEDSYANYFIHLLEIQADYHRR
SLSSLDTALAELRENHGQADHSPSMAATHFSRVYGVSLATHLHELGREIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASDPHSLEEFCSDPHAVAGALKSYLRELPEPLM
TFDLYDDWMRAASLKEPGARLQALQEVCSRLPPENLSNLRYLMKFLARLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADTLFPGDINFNVSGL
FSAVTLQDTVSDRLASEELPPTAVPTPTTTPAPAPAPVPAPALASAATKERTESEVPPRP
ASPKVTRSPPETAAPVEDMARRTKRPAPARPTMPPPQVSGSRSSPPAPPLPPGSGSPGTP
RALPRRLVGSSLRAPTVPPPLPPTPPQPARRQSRRSPASPSPASPGPASPSPVSLSTPAQ
VDLGAATAEGGAPEAVGGVPTTPAIPPQPRPRSLASETN
Download sequence
Identical sequences F6QUV4
9544.ENSMMUP00000037019 XP_005567413.1.63531 ENSMMUP00000000486 ENSMMUP00000037019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]