SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000554 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000000554
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000554   Gene: ENSMMUG00000000417   Transcript: ENSMMUT00000000603
Sequence length 116
Comment pep:known chromosome:MMUL_1:4:69587138:69588007:-1 gene:ENSMMUG00000000417 transcript:ENSMMUT00000000603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLPARRNIPPWVKVPEDLKDPEVFQVQTRLLKAMFGPDGSRIPYIEQVSKAMLELKAL
ESSDLTEVVVYGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMTALELGPWMK
Download sequence
Identical sequences A0A096N367 A0A2K5I7D3 A0A2K5LTZ0 A0A2K6K114 A0A2K6RWW2 G7P3F8
9544.ENSMMUP00000000554 ENSMMUP00000000554 XP_001112340.1.72884 XP_005552617.1.63531 XP_010370512.1.97406 XP_011799821.1.43180 XP_011922818.1.92194 XP_017726817.1.44346 ENSMMUP00000000554 ENSPANP00000006773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]