SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000576 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000576
Domain Number 1 Region: 43-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.45e-36
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000576   Gene: ENSMMUG00000000428   Transcript: ENSMMUT00000000625
Sequence length 302
Comment pep:known chromosome:MMUL_1:4:160236843:160358103:1 gene:ENSMMUG00000000428 transcript:ENSMMUT00000000625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLKFLLLTEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFV
GRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVED
AQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLA
ATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGP
EAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAAT
GN
Download sequence
Identical sequences F7HN14
ENSCJAP00000022659 ENSMMUP00000000576 ENSMMUP00000000576 9544.ENSMMUP00000000576 ENSCJAP00000022667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]