SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000640 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000640
Domain Number 1 Region: 47-271
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.11e-35
Family Regulator of chromosome condensation RCC1 0.033
Further Details:      
 
Domain Number 2 Region: 320-434
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000863
Family BTB/POZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000640   Gene: ENSMMUG00000000467   Transcript: ENSMMUT00000000691
Sequence length 467
Comment pep:known chromosome:MMUL_1:9:88362376:88363831:-1 gene:ENSMMUG00000000467 transcript:ENSMMUT00000000691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPIQATLSSLNKLDVGKFSFFSEEELQLIPQACVFVSAGLEVLYTIVIGTNCCGCLRLGN
IQSTIKPWRLDSLSGLKIASLRCGSGIYIVLATKDHNVYSQLGSGTTNHDFSTNLSNKIE
VAYGSHHSLVLISDGEVFAWGYNNSRHVKYGSTVNQPIAQRVTGCLRNKEAVNTACGQVC
SMVVVDTGEATCDYRHTLILTDEGQAYAWGANYGQFGTGNKSHHSYSTFVLVEKDRIIEI
AVCHSSHTSAAKTQGGHVYMWGQGQFVILPHLTHLVCTDDTFACFAAPAITWRLLSVEPD
DHTVAESLKREFDNLDTAVLKFVVDGKYIYAHKGLLKIVCEHVHSLLEGNEDNIVEMSEF
SYSAYWAFLEFVYTNSTSLSPEEAVGLLDLVAFYKENQLNNQGICEESAVTLLSTAVKYD
AWDLEEFCFRFCINLLTIVTNSGFASMDHDLLENFFRKESRVKAFKN
Download sequence
Identical sequences ENSMMUP00000000640 9544.ENSMMUP00000000640 ENSMMUP00000000640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]