SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000651 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000651
Domain Number 1 Region: 54-118,188-223
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.8e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0099
Further Details:      
 
Domain Number 2 Region: 207-380
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.45e-16
Family FAD/NAD-linked reductases, N-terminal and central domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000651   Gene: ENSMMUG00000000476   Transcript: ENSMMUT00000000703
Sequence length 427
Comment pep:known chromosome:MMUL_1:1:126582609:126601999:-1 gene:ENSMMUG00000000476 transcript:ENSMMUT00000000703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQTTVCSVKKQPDFSTSGQWEVVTESEGKKEMNVFDGVMVCTGHHTDAHLPLESFPGIEK
FKGQYFHSRDYKNPEGFTGKRVIIIGIGNSGGDLAVEISHTAKQVFLSTRRGAWILNRVG
NYGYPFDVLFSSRLTHFMWKICGQSLANKYLETKINQRFDHEMFGLKPKHRALSQHPTVN
DDLPNRIISGLVKVKGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFAFPFLEDSVKVV
KNKISLYKRVFPPNLERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMM
AEISKTQEKIEKRYVESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLG
PCTPIHYRLQGPGKWDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTVGRFMLALAFF
AIIIAYF
Download sequence
Identical sequences ENSMMUP00000000651 9544.ENSMMUP00000000651 ENSMMUP00000000651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]