SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000744 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000744
Domain Number 1 Region: 562-670
Classification Level Classification E-value
Superfamily Bromodomain 1.57e-32
Family Bromodomain 0.00026
Further Details:      
 
Domain Number 2 Region: 1059-1086,1113-1172
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.72e-18
Family PWWP domain 0.016
Further Details:      
 
Domain Number 3 Region: 207-279
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.17e-17
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000000744
Domain Number - Region: 320-356
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00161
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000744   Gene: ENSMMUG00000000553   Transcript: ENSMMUT00000000804
Sequence length 1188
Comment pep:known chromosome:MMUL_1:10:93733548:93781070:-1 gene:ENSMMUG00000000553 transcript:ENSMMUT00000000804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEII
LEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEP
KVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIINEKRKGDCVPA
VSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLA
VHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPE
VGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGL
YMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKDSSVKTV
RSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQRLNRIANQVAIQRKKQFVERAHSYW
LLKRLSRNGAPLLRRLQSSLQSQRSSQQRENDEEMKAAKEKLKYWQRLRHDLERARLLIE
LLRKREKLKREQVKVEQVAMELRLTPLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYL
DHIKQPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGG
VVLRQARREVDSIGLEEASGMHLAERPPVAPRRPFSWEDVDRLLDPANRAHLGLEEQLRE
LLDMLDLTCAMKSSGSRSKRAKLLKKEIALLRNKLSQQHSQPPPVGPGSEGCDEDGASLG
LEAGEEGDNSPPKLEPSDALPLPSNSETNSEPPTLKPVELNPEQSKLFKRVTFDNESHSA
CTQSALVSGRPPEPTRASSGDVPAAAASAVAEPASDVNRRTSVLFCKSKSVSPPKSAKNT
ETQPTSPQLGTKTFLSVVLPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDAGLTNGFGE
SGSEHSPACLIGLLSTPCHRLTPSRPVHPQACLAAGVFSVPKCGRGKPALVRRHTLEDRS
ELISCIENGNYAKAARIAAEVGQNSMWISTDAAASVLEPLKVVWAKCSGYPSYPALIIDP
KMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLG
IDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGEPTSDLSDID
Download sequence
Identical sequences ENSMMUP00000000744 ENSMMUP00000000744 9544.ENSMMUP00000000744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]