SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000779 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000779
Domain Number 1 Region: 47-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000173
Family V set domains (antibody variable domain-like) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000779   Gene: ENSMMUG00000000579   Transcript: ENSMMUT00000000840
Sequence length 231
Comment pep:known chromosome:MMUL_1:16:59484182:59487775:-1 gene:ENSMMUG00000000579 transcript:ENSMMUT00000000840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLALSPVSSHWLVALLLLLSAAEPVPAAKSEDLYPNPKGHACSRIWQSPRFIARKRGF
TVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNG
IYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIF
LLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
Download sequence
Identical sequences ENSMMUP00000000779 ENSMMUP00000000779 9544.ENSMMUP00000000779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]