SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000831 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000831
Domain Number 1 Region: 39-250,299-610
Classification Level Classification E-value
Superfamily ARM repeat 1.36e-104
Family Clathrin adaptor core protein 0.00000023
Further Details:      
 
Domain Number 2 Region: 863-908
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 0.00000663
Family gamma-adaptin C-terminal appendage domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000831   Gene: ENSMMUG00000000617   Transcript: ENSMMUT00000000893
Sequence length 1082
Comment pep:known chromosome:MMUL_1:7:63832249:63877534:1 gene:ENSMMUG00000000617 transcript:ENSMMUT00000000893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPAYSEDKGGSAGPGEPEYGHDPASGGIFSSDYKRHDDLKEMLDTNKDSLKLEAMKR
IVAMIARGKNASDLFPAVVKNVACKNIEVKKLVYVYLVRYAEEQQDLALLSISTFQRGLK
DPNQLIRASALRVLSSIRVPIIVPIMMLAIKEAASDMSPYVRKTAAHAIPKLYSLDSDQK
DQLIEVIEKLLADKTTLVAGSVVMAFEEVCPERIDLIHKNYRKLCNLLIDVEEWGQVVII
SMLTRYARTQFLSPTQNESLLEENAEKAFYGSEEDEAKGAGSEETAAAALPARKPYIMDP
DHRLLLRNTKPLLQSRSAAVVMAVAQLYFHLAPKAEVGVIAKALVRLLRSHSEVQYVVLQ
NVATMSIKRRGMFEPYLKSFYIRSTDPTQIKILKLEVLTNLANETNIPTVLREFQTYIRS
MDKDFVAATIQAIGRCATNIGRVRDTCLNGLVQLLSNRDELVVAESVVVIKKLLQMQPAQ
HGEIIKHLAKLTDNIQVPMARASILWLIGEYCEHVPRIAPDVLRKMAKSFTAEEDIVKLQ
VINLAAKLYLTNSKQTKLLTQYVLSLAKYDQNYDIRDRARFTRQLIVPSEQGGALSRHAK
KLFLAPKPAPVLESSFKDRDHFQLGSLSHLLNAKATGYQELPDWPEEAPDPSVRNVEVPE
WTKCSNREKRKEKEKPFYSDSEGESGPTESADSDPESESESDSKSSSESGSGESSSESDN
EDQDEDEEKGRGSESEQSEEDGKRKTKKKVPEGKGEASSSDEDSDSSSSTSESEMTSESE
EEQLEPASWRRKTPPSSKRAPATKEISLLDLEDFTPPSVQPVSPPAIVSTSLAADLEGLT
LTDSTLVPSLLSPVSRVGRQELLHRVAGEGLVVDYTFSRQPFSGDPHMVSVHIHFSNSSD
TPIKGLHVGTPKLPAGISIQEFPEIESLAPGESATAVMGINFCDSTQAANFQLCTQTRQF
YVSIQPPVGELMAPVFMSENEFKKEQGKLMGMNEITEKLMLPDTCRSDHVVVQKVTATAN
LGRVPCGTSDEYRFAGRTLTSGSLVLLTLDARPAGAAQLTVNSEKMVIGTMLVKDVIQAL
TQ
Download sequence
Identical sequences A0A2K6B8N4 F6Y1H5
ENSMMUP00000000831 ENSMMUP00000000831 XP_001082801.1.72884 XP_011766911.1.29376 9544.ENSMMUP00000000831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]