SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000841 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000841
Domain Number 1 Region: 518-865
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-120
Family Hect, E3 ligase catalytic domain 0.00000000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000841   Gene: ENSMMUG00000000628   Transcript: ENSMMUT00000000903
Sequence length 872
Comment pep:known chromosome:MMUL_1:7:4274750:4342440:-1 gene:ENSMMUG00000000628 transcript:ENSMMUT00000000903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATACKRSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRM
DNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGTRIDFK
DVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQA
KDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNLQKVGPDDVSVDIDAIRRVY
TRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLE
MALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVN
DDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGP
RVDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFI
LNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMI
AMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNP
SSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLK
DLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILN
KSVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRD
SVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTC
FNVLLLPEYSSKEKLKERLLKAITYAKGFGML
Download sequence
Identical sequences A0A0D9R273 A0A2K6A2X8 A0A2K6QUW2 H9EMG4
ENSMMUP00000000841 9544.ENSMMUP00000018225 NP_001247969.1.72884 XP_005559003.1.63531 XP_008015556.1.81039 XP_010354346.1.97406 XP_011769805.1.29376 XP_011769806.1.29376 XP_011769807.1.29376 XP_011769808.1.29376 XP_011798259.1.43180 XP_011836862.1.47321 XP_011836863.1.47321 XP_011931156.1.92194 XP_014997185.1.72884 XP_014997186.1.72884 XP_014997187.1.72884 XP_015308017.1.63531 XP_015308018.1.63531 XP_015308019.1.63531 XP_015308020.1.63531 ENSMMUP00000018225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]