SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000882 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000882
Domain Number 1 Region: 79-146,189-248
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 7.09e-21
Family Carboxylesterase 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000882   Gene: ENSMMUG00000000655   Transcript: ENSMMUT00000000944
Sequence length 253
Comment pep:known chromosome:MMUL_1:1:28585084:28600370:-1 gene:ENSMMUG00000000655 transcript:ENSMMUT00000000944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSQSVGFPPVTGPHLVGCGDVMEGQNLQGSFFRLFYPCQKAEETMEQPLWIPRYEYCT
GLAEYLQFNKRWGGLLFNLAVGSCRLPVSWNGPFKTKDSGYPLIIFSHGLGAFRTLYSAF
CMELASHGFVVAVPEHRDRSAATTYFCKQAPEENQPTNESLEEEWIPFRRVEEGEKEFHV
RNPQVHQRVSECLRVLKILQEVTAGQTVFNILPGGLDLMTLKGNIDMSRVAVMGHSFGGA
TAILALAKEIQFR
Download sequence
Identical sequences ENSMMUP00000000882 9544.ENSMMUP00000000882 ENSMMUP00000000882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]