SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000897 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000897
Domain Number 1 Region: 304-601
Classification Level Classification E-value
Superfamily Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 1.09e-112
Family Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain 0.000000244
Further Details:      
 
Domain Number 2 Region: 28-301
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-70
Family G proteins 0.0000000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000897   Gene: ENSMMUG00000000665   Transcript: ENSMMUT00000000959
Sequence length 647
Comment pep:known chromosome:MMUL_1:1:91895529:91941273:-1 gene:ENSMMUG00000000665 transcript:ENSMMUT00000000959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAFLPTPEDLYSGQRNGPNMASEIHMPGPVCLIENTKGHLVVNPEALEILSAITQPVA
VVAIVGLYRTGKSYLMNKLAGKNKGFPLGCTVKSETKGIWMWCVPHPSKSNHTLVLLDTE
GLGDMEKSDPKNDSWIFALAVLLSSSFIYNSMNTINHQALEQLHYVTELTELIRAKSCPK
PDEVEDSSEFVSFFPDFIWTVRDFTLELNLDGHPITEDEYLENALKLIPGRNPQIQNSNK
PREWIRHFFPKRKCFVFDRPTNDKNLLLHVEEVPEDQLDSNFQMQSENFCSYILTHAKTK
TLREGILVTGNRLGMLVETYLDAINSGAVPCLENAMEALAQHENSAAVQRAADHYSQRMA
QQVKFPTDTLQDLLDVHTACEREAIAVFMEHSFKDKNQEFQKKLVDTIEKKKKDFVLQNE
EASAKYCQAELKQLSELLMESISRGTFSVPGGHNIYLEAKKKIEQDYTLVPRKGIKANEV
LQSFLQSQVVIEESILQSDKALTAGEKAIAAMQAKKEAAEKEQELLRQKQKEQQQMMEAQ
ERSFQENIAQLKKKMERERENYMRELRKMLSHKLKVLEEPLTEGFKEIFESLNEEINRLK
EEIEAAENEEASVFSQILDVAGNMFIAVLPGAAKLVDLGMKILSSFM
Download sequence
Identical sequences XP_015000006.1.72884 9544.ENSMMUP00000006093 ENSMMUP00000006093 ENSMMUP00000000897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]