SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000937 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000937
Domain Number 1 Region: 5-295
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.46e-33
Family 2,6-dihydropseudooxynicotine hydrolase-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000937   Gene: ENSMMUG00000000696   Transcript: ENSMMUT00000000999
Sequence length 306
Comment pep:known chromosome:MMUL_1:2:32072562:32086741:1 gene:ENSMMUG00000000696 transcript:ENSMMUT00000000999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARLAAVAAWVPYRSWGWAAAPVGPHRGLGALLALIPQRAPRWLPACRQKTSLSFLNR
PDLPNLAYKKLKGKSPGIIFIPGYLSYMNGTKALAIEEFCKSLGHACIRFDYSGVGSSDG
NSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGWLMLHAAIARPEKVVALIGVATAAD
TLVTKFNQLPVELKKEVEMKGVWSMPSKYSEEGVYNVQYSFIKEAEHHCLLHSPIPVNCP
IRLLHGMKDDIVPWHTSMQVADRVLSTDVDVILRKHSDHQMKEKADIQLLVYTIDDLIDK
LSTIVN
Download sequence
Identical sequences A0A2K5ME28 A0A2K5WKD0 A0A2K5YPX1 A0A2K6AVF3 H9ZAW9
ENSMMUP00000000937 9544.ENSMMUP00000000937 ENSMMUP00000000937 NP_001248431.1.72884 XP_005548242.1.63531 XP_011720700.1.29376 XP_011825117.1.47321 XP_011938435.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]