SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000000957 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000000957
Domain Number 1 Region: 286-579
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-58
Family Kelch motif 0.000062
Further Details:      
 
Domain Number 2 Region: 15-132
Classification Level Classification E-value
Superfamily POZ domain 4.76e-36
Family BTB/POZ domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000000957   Gene: ENSMMUG00000000709   Transcript: ENSMMUT00000001020
Sequence length 590
Comment pep:known chromosome:MMUL_1:19:18286249:18290999:1 gene:ENSMMUG00000000709 transcript:ENSMMUT00000001020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHSTADKNGALKCTFSAPSHSTSLLQGLATLRAQGQLLDVVLTINREAFPAHKVVLAACS
DYFRAMFTGGMREASQDVIELKGVSARGLRHIIDFAYSAEVTLDLDCVQDVLGAAVFLQM
LPVVELCEEFLKAAMSVETCLNIGQMATTFSLASLRESVDAFTFRHFLQIAEEEDFLRLP
LERLVFFLQSNRLQSCAEIDLFRAAVRWLQHDPARRPRASHVLCHIRFPLMQSSELVDSV
QTLDIMVEDVLCRQYLLEAFNYQVLPFRQHEMQSPRTAVRSDVPSLVTFGGTPYTDSDRS
VSSKVYQLPEPGARHFRELTEMEVGCSHTCVAVLDNFVYVAGGQHLQYRSGEGAVDACYR
YDPHLNRWLRLQAMQESRIQFQLNVLCGMVYATGGRNRAGSLASVERYCPRRNEWGYACS
LKRRTWGHAGAASGGRLYISGGYGISVEDKKALHCYDPVADQWEFKAPMSEPRVLHAMVG
AGGRIYALGGRMDHVDRCFDVLAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERKIYIVG
GYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAGIACAPVLLPRAGTRR
Download sequence
Identical sequences ENSMMUP00000000957 9544.ENSMMUP00000000957 ENSMMUP00000000957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]