SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001012 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001012
Domain Number 1 Region: 130-186
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000183
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 45-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000785
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001012   Gene: ENSMMUG00000000752   Transcript: ENSMMUT00000001080
Sequence length 729
Comment pep:known chromosome:MMUL_1:6:111790:199934:1 gene:ENSMMUG00000000752 transcript:ENSMMUT00000001080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGCPVFSRPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLAS
LLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGVPSPRDSRPLAGSAV
LEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCR
QLHWAMDPPQVVFGQPPPLETGDDAILGRLLRAQEWGAGAPTEYSAFLTRCFICRVRCLL
DSTSGFLALESQAWQLLLCCPSLKHQTMQFQGKLKFLFGQKKKAPSGAVLPPRLSLFCIV
APVLLPSTAEMKMRSALLRAKPRADTVATTDAKVKAATSLCESEPRGEPNYSAGRSSRES
GVLVLREQTDAGSCSASPKRPPPKATRPGVFSSVEWAPSFLCRDREEEQHKMLSRASGVT
GHRETPGPTKPLPWTAGRHGEDGARPRLQPSKSDPPCLRPTPRGSCLPYSCVQGTFRNSP
ISHPPSPSPSAYSSRTSRPVRNVGEDQVHPPLCHFPQGSLQHRLPQPGAQRFATRGYPME
DVKLQGVPMPPGDLCGPTLLLDVPIKMEKDSGSEDAADGCVPSQVWLGASDRSHPATFPT
RMHLKTEPDSRQQVYISHLGHGVRGTQPHGRATVGRSRELTPFHPAHCACLEPMHGLAQP
EPPHQLCARGQGEQSCACRAAEATPVVKREPLDSPPWATHSQGAVPGMFPKSALATLVLP
QASECTFLP
Download sequence
Identical sequences ENSMMUP00000001012 9544.ENSMMUP00000001012 ENSMMUP00000001012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]