SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001032 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001032
Domain Number 1 Region: 21-141
Classification Level Classification E-value
Superfamily Translational machinery components 7.19e-31
Family Ribosomal protein L18 and S11 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001032   Gene: ENSMMUG00000000764   Transcript: ENSMMUT00000001101
Sequence length 147
Comment pep:known chromosome:MMUL_1:1:1915312:1915755:-1 gene:ENSMMUG00000000764 transcript:ENSMMUT00000001101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGKEKKEEQVISLGPQVAEGENVFGVRHIFASFSDTSVHVTDLSGKETICRVTGGMRVKA
DRDKSSPYAAMLAARDVAQKCKELGITALRIKLQATGGNRTQDRGPGAQSTLTALARSGM
KIGQIEDVTPIPSDSTRRKGGHHGHCL
Download sequence
Identical sequences ENSMMUP00000001032 9544.ENSMMUP00000001032 ENSMMUP00000001032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]