SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001117 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001117
Domain Number 1 Region: 294-488
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.06e-51
Family Reprolysin-like 0.00038
Further Details:      
 
Domain Number 2 Region: 586-643
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 8.5e-17
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 1124-1177
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000628
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 930-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 994-1048
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 1054-1115
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000068
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001117
Domain Number - Region: 883-931
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00209
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001117   Gene: ENSMMUG00000000824   Transcript: ENSMMUT00000001190
Sequence length 1221
Comment pep:known chromosome:MMUL_1:20:75448128:75599753:-1 gene:ENSMMUG00000000824 transcript:ENSMMUT00000001190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECALLLACALPAAGSGPPRGPAGLGRVAKAERLCCLCCASVAAALASDSSSGASGLNDD
YVFVTPVEVDSAGSYISHDILHNGRKKRSAQNARSSLHYRFSAFGQELHLELKPSAILSS
HFIVQVVGKDGASETLKPEVQQCFYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISP
LPQLLAQEHNYSSPAGHHPHVLYKRTAEEKVQRYRGYPSSGQNYPGYSPSHIPHASQSQE
TEYHHRRLQKQHFCGRRKKYAPKPPTEDTYLRFDEYGSSGRPRRSAGKSQKGLNVETLVV
ADKKMVEKHGKGNVTTYILTVMNMVSGLFKDGTIGSDINVVVVSLILLEQEPGGLLINHH
ADQSLNSFCQWQSALIGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRSC
TINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFSWSSCSRQ
YLKKFLSGDRIVLHRRENKSSVELPFDLSINRKTNDDDDDDDDIIVKKNRLKPNIVLNDI
CKSLWCHRVGHRCETKFMPAAEGTVCGLSMWCRQGQCVKFGELGPRPIHGQWSAWSKWSE
CSRTCGGGVKYQERHCNNPKPQYGGKFCPGSSRIYQLCNINPCNENSLDFRAQQCAEYNS
KPFRGWFYQWKPYTKVEEEDRCKLYCKAENFEFFFAMSGKVKDGTPCSPNKNDVCIDGVC
ELVGCDHELGSKAVSDACGSKGGYDSKTSLYKNEHYMSRAISKYYPVVIIPAGARSIEIQ
ELQVSSSYLAVRSLSQKYYLTGSWSIDWPGEFPFAGTTFEYQRSFNLPERLYAPGPTNET
LVFEILMQGKNPGIAWKYALPKVMNGTPPATKRPAYAWSIVQSECPVSCGGGYINVKAIC
LRDQNIQVNSSFCSVRTKPVTEPKICNAFSCPAYWMPGEWSTCSKSCAGGQQSRKIQCVQ
KKPFQKEEAVLHSLCPVSTPTQVQACNSHACPPEWSLGPWSQCSKTCGRGVRRRELLCKG
SAAETLPESQCTSLPRPELQEGCVLGRCPKNNRLQWVASSWSECSATCGLGVRKREIKCS
EKGFQGKLITFPERRCRNIKRPNLDLEETCNQRACPAHPVYNVVAGWYSSPWQQCTVTCG
GGVQTRSVHCVQQGRPSSSCLLHQKPPVLRACNTNFCPAPEKREDPSCVDFFNWCHLVPQ
HGVCNHKFYGKQCCKSCTRKI
Download sequence
Identical sequences ENSMMUP00000001117 ENSMMUP00000001117 9544.ENSMMUP00000001117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]