SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001196 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001196
Domain Number 1 Region: 296-358
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.34e-19
Family LIM domain 0.0029
Further Details:      
 
Domain Number 2 Region: 237-299
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.04e-18
Family LIM domain 0.01
Further Details:      
 
Domain Number 3 Region: 355-417
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.15e-16
Family LIM domain 0.0062
Further Details:      
 
Domain Number 4 Region: 414-444
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000931
Family LIM domain 0.01
Further Details:      
 
Domain Number 5 Region: 209-235
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000104
Family LIM domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001196   Gene: ENSMMUG00000000896   Transcript: ENSMMUT00000001276
Sequence length 444
Comment pep:known chromosome:MMUL_1:20:29567392:29573096:1 gene:ENSMMUG00000000896 transcript:ENSMMUT00000001276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAP
PFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPS
LPSSPSPGLPKPSATSATLELDRLMASLSDFRVQNHLPASGPTQPPVASSTNEGSPSPPE
PTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGC
STALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCG
EPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFA
PFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
LTKGSFQERAGKPYCQPCFLKLFG
Download sequence
Identical sequences A0A2K5LQQ0 A0A2K5WX04 F6T778
XP_005591809.1.63531 ENSMMUP00000001196 ENSMMUP00000001197 ENSMMUP00000001196 9544.ENSMMUP00000001196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]