SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001272 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001272
Domain Number 1 Region: 105-182
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.75e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001272   Gene: ENSMMUG00000000947   Transcript: ENSMMUT00000001354
Sequence length 217
Comment pep:known chromosome:MMUL_1:8:74392408:74395316:-1 gene:ENSMMUG00000000947 transcript:ENSMMUT00000001354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNSSAEEEDPDGEEERCA
LGAAGSAGGCKRKRPRVAGGGGAGGSAGGGGKKPLPAKGSAAECKQSQRNAANARERARM
RVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGYVHPVNLTW
PFVVSGRPDSPKKFPQPTDYVEPPLKSYWNSLDGIIR
Download sequence
Identical sequences ENSMMUP00000001272 9544.ENSMMUP00000001272 ENSMMUP00000001272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]