SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001295 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001295
Domain Number 1 Region: 493-627,654-792
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.06e-68
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 186-476
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.05e-66
Family Ankyrin repeat 0.0000126
Further Details:      
 
Domain Number 3 Region: 802-945
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.62e-39
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 1106-1309
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.4e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.002
Further Details:      
 
Domain Number 5 Region: 1027-1088
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000334
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001295   Gene: ENSMMUG00000000965   Transcript: ENSMMUT00000001377
Sequence length 1327
Comment pep:known chromosome:MMUL_1:8:10944691:11170841:-1 gene:ENSMMUG00000000965 transcript:ENSMMUT00000001377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDGTSCCNTTSTICTVAAAPVVPAVSTSSSVGVAPNP
AGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERK
EGEVTGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTA
TAAEQKT
Download sequence
Identical sequences A0A2K6DKG0 F6QQJ9
9544.ENSMMUP00000001295 NP_001248210.1.72884 XP_011755611.1.29376 ENSMMUP00000001295 ENSMMUP00000001295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]