SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001309 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001309
Domain Number 1 Region: 181-459
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-75
Family Protein kinases, catalytic subunit 0.000000000135
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000147
Family SH3-domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000001309
Domain Number - Region: 1035-1081
Classification Level Classification E-value
Superfamily UBA-like 0.0172
Family UBA domain 0.025
Further Details:      
 
Domain Number - Region: 68-126
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0523
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001309   Gene: ENSMMUG00000000972   Transcript: ENSMMUT00000001391
Sequence length 1085
Comment pep:known chromosome:MMUL_1:2:189531915:189573866:1 gene:ENSMMUG00000000972 transcript:ENSMMUT00000001391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEARPPRTQGSDAGAAAGRGLRAPLLSLTAATGVWSMGERAAYQRLAGGEEGPQRLGGG
SMQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRL
WEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTC
LIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVN
AMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEG
MGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAP
ESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQD
IYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGR
AENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFP
DRIDELYLGNPMDPPDLLSVELSTSRPPQHLGGVKTCLPPPACPPESGLWSTKPTYDPVS
EDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKAGRGSGAEVTLIDFGEEPVVPAL
RPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLPPPPAYDDVAQDE
DDFEVCSINSTLVGMGVPAGPSQGETNYAFVPEQGRPPPPLEDNLFLPPQGGGKPPSSAQ
TAEIFQALQQECMRQLQVPAGSLTPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPSG
EEETGRWPGPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFA
SDPKYATPQVIQAPGPRAGPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSP
EEPAPLPVPLLLPPPSTPAPAAPTATVRPMPQAASDPKANFSTNNSNPGARPPAPRATAR
LPQRGCPGDGPEAGRPADKIQMVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWG
PAHHK
Download sequence
Identical sequences ENSMMUP00000038203 9544.ENSMMUP00000038203 ENSMMUP00000001309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]