SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001541 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001541
Domain Number 1 Region: 6-91
Classification Level Classification E-value
Superfamily t-snare proteins 1.02e-23
Family t-snare proteins 0.00000524
Further Details:      
 
Domain Number 2 Region: 124-183
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000000916
Family SNARE fusion complex 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001541   Gene: ENSMMUG00000001161   Transcript: ENSMMUT00000001637
Sequence length 186
Comment pep:known chromosome:MMUL_1:9:112106848:112329170:1 gene:ENSMMUG00000001161 transcript:ENSMMUT00000001637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDFEGYEQDAVLTAEITSKIARVARLPPDEKKQMVANVEKQLEEAKELLEQMDLEVRE
IPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLDN
TERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRIL
TGMLRR
Download sequence
Identical sequences 9544.ENSMMUP00000001541 ENSMMUP00000001541 ENSMMUP00000001541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]