SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001542 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001542
Domain Number 1 Region: 83-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000563
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001542   Gene: ENSMMUG00000001160   Transcript: ENSMMUT00000001638
Sequence length 227
Comment pep:known chromosome:MMUL_1:1:1697950:1701289:1 gene:ENSMMUG00000001160 transcript:ENSMMUT00000001638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSAGHGELGASAGCLGAVGVGLLLGAGGSQPGQEGILREGPSAHLQQWTVRMGLCRALRT
ASRPPTPWAWPPQPDGSVSGSFRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHI
KKLEEQDRRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIE
GMEFGPGELDSVGSSSDADDHYSLQSGSGGDSGFGPHCRRLGRPALS
Download sequence
Identical sequences ENSMMUP00000001542 ENSMMUP00000001542 9544.ENSMMUP00000001542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]