SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001579 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001579
Domain Number 1 Region: 279-488
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.04e-18
Family Spore coat polysaccharide biosynthesis protein SpsA 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001579   Gene: ENSMMUG00000001182   Transcript: ENSMMUT00000001675
Sequence length 533
Comment pep:known chromosome:MMUL_1:11:54703525:54712799:-1 gene:ENSMMUG00000001182 transcript:ENSMMUT00000001675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLGRRALCALVLLVACASLGLLYASTRDAPGLRAPLAPWAPPQSPRRPELPDLAPEPRY
AHIPVRIKEQVVRLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELSAASATREQ
EFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNL
TASLGTWDVAGEVTGVTLIGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRF
STEGHEAAFTVRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIR
RFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFV
FTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFH
HELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVV
VDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
Download sequence
Identical sequences G7N7G9 G7PIW2
XP_001116271.1.72884 XP_005571405.1.63531 XP_005571406.1.63531 XP_015007617.1.72884 XP_015007618.1.72884 ENSMMUP00000001579 ENSMMUP00000001579 9544.ENSMMUP00000001579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]