SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001672 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001672
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.25e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000684
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 7.07e-36
Family Third domain of FERM 0.00016
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-33
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 4 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-20
Family PDZ domain 0.0000991
Further Details:      
 
Domain Number 5 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.47e-20
Family First domain of FERM 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001672   Gene: ENSMMUG00000001250   Transcript: ENSMMUT00000001775
Sequence length 913
Comment pep:known chromosome:MMUL_1:15:26736714:26824573:1 gene:ENSMMUG00000001250 transcript:ENSMMUT00000001775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIYFLDGVVQTFKVTKQDTGQVLLDMTYN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSVHHPGYLSDSQFIPDQ
NDDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
IAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSLHQESLSENNPAQSYRTQKSSSSVSPSSNAPGSCSPDGVDQQFLDD
FHRVTKGGSTEDTSQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIAAQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMDYGSFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPVYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences A0A2K6BRA4 F7HG49 G7PRQ2
ENSMMUP00000001672 9544.ENSMMUP00000001672 XP_011738605.1.29376 XP_011738606.1.29376 XP_014972609.1.72884 XP_014972610.1.72884 ENSMMUP00000001672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]