SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001730 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001730
Domain Number 1 Region: 2-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-45
Family FCH domain 0.012
Further Details:      
 
Domain Number 2 Region: 512-595
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-22
Family SH3-domain 0.00057
Further Details:      
 
Domain Number 3 Region: 415-486
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000919
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001730   Gene: ENSMMUG00000001294   Transcript: ENSMMUT00000001834
Sequence length 684
Comment pep:known chromosome:MMUL_1:14:70924129:71257660:-1 gene:ENSMMUG00000001294 transcript:ENSMMUT00000001834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQKLASQYLKRDWPGVKADDRNDYRSMYPVWKSFLEGTMQVAQSRMNICENYKNFISEPA
RTVRSLKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSK
LSLFQSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKA
LDGNVYDHLKDYLIAFSRTELETCQAVQNTFQFLLENSSKVVRDYNLQLFLQENAVFHKP
QPFQFQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDDLECHG
PAVSEQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMSQVMEE
LENERWARPPAVTSNGTLHSLNADTEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKV
VYSYKASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSM
LQSLATLDSRSHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRI
LNKENQDDDGFWEGEFNGRIGVFPSVLVEELSASENGDTPWMREIQISPSPKPHASLPPL
PLYDQPPSSPYPSPDKRSSLYFPRSPSANENSLHAESPGFSQASRHTPETSHGKLRPVRA
APPPPMQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences 9544.ENSMMUP00000001730 ENSMMUP00000001730 ENSMMUP00000001730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]