SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001751 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001751
Domain Number 1 Region: 535-747
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-51
Family DBL homology domain (DH-domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 870-1025
Classification Level Classification E-value
Superfamily PH domain-like 8.58e-33
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 4 Region: 732-857
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-30
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.2e-27
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-20
Family First domain of FERM 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001751   Gene: ENSMMUG00000001313   Transcript: ENSMMUT00000001856
Sequence length 1055
Comment pep:known chromosome:MMUL_1:12:105292345:105424258:1 gene:ENSMMUG00000001313 transcript:ENSMMUT00000001856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTVEIFDT
EPKCDGQILLTEVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDEMLD
REHLKANEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHMSIRALTADLPKQSISFPEGLRTPGSPSSANASFYSLSPSTLVPPGL
PEFKDSSSSLTEPQVSYIKSPAAERSSGAVAGGPDTPSAQPVGPPALQPGPGLSTKSPQP
SPSSRNSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDYEEPRHKRMPADEAYFI
VKEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQ
RLALWEAPSKAHTKGSHQRIGDILLRNMLQLKEFTSYFQRHDEVLTELEKATKRFKKLEA
VYKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYTPGHHDYADCHDALKAITEV
TTTLQHILIRLENLQKLTELQRDLVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFS
DMLLYTSKGVAGTSHFRIRGLLPLRGMLVEESENEWSVPHCFTIYAAQKTIVVAASTRLE
KEKWMLDLNNAIQAAKSGGDTAPALPGSTVCTRPPRSPNEVSLEQESEDDARGARSSLEG
HGQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLF
FYKTHQDDYPLASLPLLGYSVSTPQEADGIHKDYVFKLQFKSHVYFFRAESKYTFERWME
VIQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE
Download sequence
Identical sequences A0A2K5VKC6
XP_005574940.1.63531 XP_005574941.1.63531 XP_005574942.1.63531 XP_005574943.1.63531 XP_015288599.1.63531 9544.ENSMMUP00000001751 ENSMMUP00000001751 ENSMMUP00000001751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]