SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001762 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001762
Domain Number 1 Region: 54-129
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.76e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001762   Gene: ENSMMUG00000001322   Transcript: ENSMMUT00000001867
Sequence length 193
Comment pep:known chromosome:MMUL_1:14:2277079:2277660:-1 gene:ENSMMUG00000001322 transcript:ENSMMUT00000001867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGALPRSAPPAPRVPVSCAARRRPTSPELLRCSRRRRPATAETGDSAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
RPPAVRPSAPRGQPGTTAVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences F7BGV6
ENSMMUP00000001762 ENSMMUP00000001762 9544.ENSMMUP00000001762 XP_001117240.2.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]