SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001795 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001795
Domain Number 1 Region: 197-316
Classification Level Classification E-value
Superfamily EF-hand 3.81e-35
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 285-380
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-27
Family Thyroglobulin type-1 domain 0.00085
Further Details:      
 
Domain Number 3 Region: 134-181
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000018
Family Ovomucoid domain III-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001795   Gene: ENSMMUG00000001344   Transcript: ENSMMUT00000001902
Sequence length 439
Comment pep:known chromosome:MMUL_1:6:133398162:133907558:-1 gene:ENSMMUG00000001344 transcript:ENSMMUT00000001902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAIAVLAAAAAAWCFLQVESRHLDALAGGAGPNHGNFLDNDQWLSTVSQYDRDKYWNRF
RDDDYFRNWNPNKPFDQALDPSKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKG
NVAHKHWVGPSNLVKCKPCPVAQSAMVCGSDGHSYTSKCKLEFHACSTGKSLTTLCDGPC
PCLPEPEPPKHKAERSACTDKELRNLASRLKDWFGALHEDANRVIKPTSSNTAQGRFDTS
ILPICKDSLGWMFNKLDMNYDLLLDHSEINAIYLDKYEPCIKPLFNSCDSFKDGKLSNNE
WCYCFQKPGGLPCQNEMNRIQKLSKGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDK
YGNELAGSRKQGAVSCEEEQETSGDFGSGGSVVLLDDLEDERELGPKDKEGKLRVHTRAV
TEDDEDEDDDKEDEVGYIW
Download sequence
Identical sequences A0A096NEA0 A0A2K5WZ19 A0A2K6D867 F7B8Z2 H2PGM5
ENSPPYP00000017679 NP_001253464.1.72884 XP_005557916.1.63531 XP_011714785.1.29376 ENSMMUP00000001795 ENSPPYP00000017679 9544.ENSMMUP00000001795 9600.ENSPPYP00000017679 ENSMMUP00000001795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]