SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000001799 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000001799
Domain Number 1 Region: 627-826
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-33
Family Fibronectin type III 0.0000962
Further Details:      
 
Domain Number 2 Region: 829-1023
Classification Level Classification E-value
Superfamily Fibronectin type III 3.97e-32
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 257-354
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-18
Family I set domains 0.0091
Further Details:      
 
Domain Number 4 Region: 341-436
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-18
Family I set domains 0.0092
Further Details:      
 
Domain Number 5 Region: 443-530
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 539-652
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000663
Family I set domains 0.021
Further Details:      
 
Domain Number 7 Region: 139-225
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000169
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 54-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000516
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000001799   Gene: ENSMMUG00000001349   Transcript: ENSMMUT00000001906
Sequence length 1226
Comment pep:known chromosome:MMUL_1:2:60628830:60714874:-1 gene:ENSMMUG00000001349 transcript:ENSMMUT00000001906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRLNGKGLIISLIFFLLKFSTAIEIPPSGKVTAFTICQENSYLSFSFCGWLIYDCFVN
KYSKNIFTWTKDGNPFHFTDHRIITSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMS
EEIEFIVPKCVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDER
VYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEI
GSKANSIKQRKPKLLLPPTESGSESSITILKGETLLLECFAEGLPTPQVDWNKIGGDLPK
GRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYS
TGSNGILLCEAEGEPQPTIKWRVNGSPIDNHPFAGDVVFPREISFTNLQPNHTAVYQCEA
SNVHGTILASANVDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEA
KPLEGRRYHVYDNGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATQLRVSPKN
PRIPKLHMLELHCESKCDLHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTL
EDQGIYCCSALTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRLSWEAGDDHNSNIS
EYIVEFEGNKEDPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQPSDH
HETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEE
TVTNHTLRVMTPAVYAPYDVKVQAINQLGSGPAPQSVTLYSGEDYPDTAPVIHGVDVINS
TLVKVTWSTIPKDRVHGRLKGYQINWWKTKSLLDGRTHPKEVNVLRFSGQRNSGMVPSLD
AFSEFHLTVLAYNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLN
GNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHLSNLNATTKYKFYLRACTSRGCGK
PITEESSTLGEGSKGIGKISEGVNLTQKTHPIEVFEPGAEHIVRLMTKNWGDNDSIFQDV
IETRGREYAGLYDDISTQGWFIGLMCAIALLTLVLLTVCFVKRNRGGKYSVKEKEDLHPD
PEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHALFNEDGSFI
GAYAGSKEKGSVESNGSSTATFPLRA
Download sequence
Identical sequences ENSMMUP00000001799 ENSMMUP00000001799 9544.ENSMMUP00000001799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]