SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000002081 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000002081
Domain Number 1 Region: 95-168
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000002081   Gene: ENSMMUG00000001558   Transcript: ENSMMUT00000002203
Sequence length 253
Comment pep:known chromosome:MMUL_1:3:13485273:13486031:-1 gene:ENSMMUG00000001558 transcript:ENSMMUT00000002203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRVNAAPGTMLRPQRPGDVQLGASLYELVGYRQPPSSSSSSTTSSTSSSSTTAPLLPKAA
REKPEAPAEPPGPGPGSGAHAGVSARPDAKEEQQQQLRRKINSRERKRMQDLNLAMDALR
EVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGSSLQELRRALGEGAGPAAPRLLLA
GLPLLAAAPGSVLLAPGAVGPPDALRPAKYLSLALDEPPCGQFALPGGGTGGPGLCTCAV
CKFPHLVPASLGL
Download sequence
Identical sequences ENSMMUP00000002081 9544.ENSMMUP00000002081 ENSMMUP00000002081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]